Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCD4 Rabbit Polyclonal Antibody (HRP)

ABCD4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P70R, P79R, ABC41, MAHCJ, PMP69, PXMP1L, EST352188

UniProt

O14678

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ABCD4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

EAW81165

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Cyanobenzaldehyde
007155 25 g

2-Cyanobenzaldehyde

Sign In for Pricing
View Details
PLGF-2, human recombinant protein
P1056-.005 5 µg

PLGF-2, human recombinant protein

Sign In for Pricing
View Details
Human TPRG1 Protein Lysate
MBS8429019-01 0.02 mg

Human TPRG1 Protein Lysate

Sign In for Pricing
View Details
Human TPRG1 Protein Lysate
MBS8429019-02 5x 0.02 mg

Human TPRG1 Protein Lysate

Sign In for Pricing
View Details
MFSD4 Protein Vector (Rat) (pPB-C-His)
PV282066 500 ng

MFSD4 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
BNIP3L (BCL2/Adenovirus E1B 19kD Protein-interacting Protein 3-like, Adenovirus E1B19K-Binding Protein B5, BCL2/Adenovirus E1B 19kD Protein-interacting Protein 3A, NIP3-like Protein X, NIP3L, BNIP3A, BNIP3H, NIX) (MaxLight 490)
MBS6371382-01 0.1 mL

BNIP3L (BCL2/Adenovirus E1B 19kD Protein-interacting Protein 3-like, Adenovirus E1B19K-Binding Protein B5, BCL2/Adenovirus E1B 19kD Protein-interacting Protein 3A, NIP3-like Protein X, NIP3L, BNIP3A, BNIP3H, NIX) (MaxLight 490)

Sign In for Pricing
View Details