Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCD4 Rabbit Polyclonal Antibody (HRP)

ABCD4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P70R, P79R, ABC41, MAHCJ, PMP69, PXMP1L, EST352188

UniProt

O14678

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ABCD4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

EAW81165

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBPF8 Antibody (N-term)
MBS9206184-01 0.08 mL

NBPF8 Antibody (N-term)

Sign In for Pricing
View Details
NBPF8 Antibody (N-term)
MBS9206184-02 0.4 mL

NBPF8 Antibody (N-term)

Sign In for Pricing
View Details
NBPF8 Antibody (N-term)
MBS9206184-03 5x 0.4 mL

NBPF8 Antibody (N-term)

Sign In for Pricing
View Details
1- (2-Aminophenyl) imidazolidin-2-one
WMB38618-01 250 mg

1- (2-Aminophenyl) imidazolidin-2-one

Sign In for Pricing
View Details
1- (2-Aminophenyl) imidazolidin-2-one
WMB38618-02 2.5 g

1- (2-Aminophenyl) imidazolidin-2-one

Sign In for Pricing
View Details
Recombinant Human IFNAR2 Protein
MBS8249198-01 0.01 mg

Recombinant Human IFNAR2 Protein

Sign In for Pricing
View Details