Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Abcb10 Rabbit Polyclonal Antibody (HRP)

Abcb10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ABC-m, Abc-me, Abcb12

UniProt

Q9JI39

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NGIRVYLMQSSGQSIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_062425

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JTB Protein Vector (Human) (pPB-N-His)
PV022010 500 ng

JTB Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
SIRPα / γ Human Monoclonal Antibody
orb2977686-01 100 µg

SIRPα / γ Human Monoclonal Antibody

Sign In for Pricing
View Details
SIRPα / γ Human Monoclonal Antibody
orb2977686-02 1 mg

SIRPα / γ Human Monoclonal Antibody

Sign In for Pricing
View Details
Triqk (NM_001171801) Mouse Tagged Lenti ORF Clone
MR226002L3 10 µg

Triqk (NM_001171801) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
HAUS2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
23022124 3x 1.0µg DNA

HAUS2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
GPRC5B CRISPR All-in-one AAV vector set (with saCas9)(Human)
22604151 3x 1.0 µg DNA

GPRC5B CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details