Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCF3 Rabbit Polyclonal Antibody (FITC)

ABCF3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EST201864

UniProt

Q9NUQ8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ABCF3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLL

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060828

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDCP2 3'UTR Luciferase Stable Cell Line
TU016060 1.0 mL

NUDCP2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ATG16 (Autophagy-Related Protein 16) (MaxLight 550) discontinued
214518-ML550 100 µL

ATG16 (Autophagy-Related Protein 16) (MaxLight 550) discontinued

Sign In for Pricing
View Details
TRAF3, CT (TRAF3, CAP1, CRAF1, TNF receptor-associated factor 3, CAP-1, CD40 receptor-associated factor 1, CD40-binding protein, LMP1-associated protein 1) (FITC) discontinued
043182-FITC 200 µL

TRAF3, CT (TRAF3, CAP1, CRAF1, TNF receptor-associated factor 3, CAP-1, CD40 receptor-associated factor 1, CD40-binding protein, LMP1-associated protein 1) (FITC) discontinued

Sign In for Pricing
View Details
CYP20A1 Knockout MES-OV Polyclonal Cells
ARG6511 1 Million

CYP20A1 Knockout MES-OV Polyclonal Cells

Sign In for Pricing
View Details
Recombinant Human CD9 protein, C-His Tag
MBS1560521-01 0.05 mg

Recombinant Human CD9 protein, C-His Tag

Sign In for Pricing
View Details
Recombinant Human CD9 protein, C-His Tag
MBS1560521-02 0.1 mg

Recombinant Human CD9 protein, C-His Tag

Sign In for Pricing
View Details