Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC17A4 Rabbit Polyclonal Antibody (Biotin)

SLC17A4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KAIA2138

UniProt

Q9Y2C5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLC17A4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YFCEYWLFYTIMAYTPTYISSVLQANLRDSGILSALPFVVGCICIILGGL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_005486

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Disintegrin and Metalloproteinase domain-containing protein 22 (ADAM22) Mouse ELISA Kit
C9166 96 Tests

Disintegrin and Metalloproteinase domain-containing protein 22 (ADAM22) Mouse ELISA Kit

Sign In for Pricing
View Details
Transcription Factor YY1 (CF1, Delta Transcription Factor, NF E1, NF-E1, Transcriptional Repressor Protein YY1, UCR Motif DNA Binding Protein, UCRBP, Yin and Yang 1, Yin Yang 1, Yin-Yang 1, YY 1, YY1, YY-1, YY1 Transcription Factor) (AP) discontinued
T8195-90D-AP 100 µL

Transcription Factor YY1 (CF1, Delta Transcription Factor, NF E1, NF-E1, Transcriptional Repressor Protein YY1, UCR Motif DNA Binding Protein, UCRBP, Yin and Yang 1, Yin Yang 1, Yin-Yang 1, YY 1, YY1, YY-1, YY1 Transcription Factor) (AP) discontinued

Sign In for Pricing
View Details
Phospho-Tie2 (Ser1119) Rabbit Polyclonal Antibody (PerCP)
orb2429607 100 µL

Phospho-Tie2 (Ser1119) Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
4930408F14Rik 3'UTR GFP Stable Cell Line
TU150660 1.0 mL

4930408F14Rik 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rat Anti-Mouse IL-17-LE/AF
MBS670091-01 0.5 mg

Rat Anti-Mouse IL-17-LE/AF

Sign In for Pricing
View Details
Rat Anti-Mouse IL-17-LE/AF
MBS670091-02 5x 0.5 mg

Rat Anti-Mouse IL-17-LE/AF

Sign In for Pricing
View Details