Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A22 Rabbit Polyclonal Antibody (FITC)

SLC25A22 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GC1, DEE3, GC-1, EIEE3, NET44

UniProt

Q9H936

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A22

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_078974

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cathepsin D (CTSD) ELISA Kit
DL-CTSD-Ra-01 48 Tests

Rat Cathepsin D (CTSD) ELISA Kit

Sign In for Pricing
View Details
Rat Cathepsin D (CTSD) ELISA Kit
DL-CTSD-Ra-02 96 Tests

Rat Cathepsin D (CTSD) ELISA Kit

Sign In for Pricing
View Details
Aedes aegypti (Yellowfever mosquito) AeLoqs Antibody Fluoro647 Conjugated
orb3166436 200 µL

Aedes aegypti (Yellowfever mosquito) AeLoqs Antibody Fluoro647 Conjugated

Sign In for Pricing
View Details
Interleukin-1 (IL-1) Receptor (PE) discontinued
I7663-25G3-PE 200 µL

Interleukin-1 (IL-1) Receptor (PE) discontinued

Sign In for Pricing
View Details
Anti-Annexin A3 Antibody Picoband® (monoclonal, 2H3H8), APC Conjugate
M04796-2-APC 100 µg/Vial

Anti-Annexin A3 Antibody Picoband® (monoclonal, 2H3H8), APC Conjugate

Sign In for Pricing
View Details
Lentiviral human ACTRT3 shRNA (UAS) - Lentiviral human ACTRT3 shRNA (UAS, GFP) (25)
GTR15127376 1 Vial

Lentiviral human ACTRT3 shRNA (UAS) - Lentiviral human ACTRT3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details