Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lrp8 Rabbit Polyclonal Antibody (HRP)

Lrp8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Lr, ap, Lr8b, ApoER2, AA921429, AI848122, 4932703M08Rik

UniProt

Q924X6

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NRKMLIFSTDFLSHPFGVAVFEDKVFWTDLENEAIFSANRLNGLEIAILA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

110kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_444303

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIP30 (FAM192A) (NM_024946) Human Over-expression Lysate
LC403039 20 µg

NIP30 (FAM192A) (NM_024946) Human Over-expression Lysate

Sign In for Pricing
View Details
Desmin (Muscle Cell Marker) (DES/2960R), CF405S conjugate, 0.1mg/mL
BNC042960-100 1x 100 µL

Desmin (Muscle Cell Marker) (DES/2960R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Virginiamycin S1
TRC-V673813-1MG 1 mg

Virginiamycin S1

Sign In for Pricing
View Details
OAS2 (NM_001032731) Human Over-expression Lysate
LY422333 100 µg

OAS2 (NM_001032731) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS807378 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Retinoic Acid Receptor alpha (RARA) Rabbit Polyclonal Antibody
TA372984 100 µL

Retinoic Acid Receptor alpha (RARA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details