Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR6C68 Rabbit Polyclonal Antibody (HRP)

OR6C68 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

A6NDL8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human OR6C68

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MQKSVMRKHTAITTFILLGLTEDPQLQVLLFMFLFITYMLSVTGKLTIIA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001005519

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGP9.5 Rabbit mAb
AB102496 100 µL

PGP9.5 Rabbit mAb

Sign In for Pricing
View Details
Human Allergen-specific IgE antibody (Inhalation group) ELISA Kit
AE64589HU-01 48 Tests

Human Allergen-specific IgE antibody (Inhalation group) ELISA Kit

Sign In for Pricing
View Details
Human Allergen-specific IgE antibody (Inhalation group) ELISA Kit
AE64589HU-02 96 Tests

Human Allergen-specific IgE antibody (Inhalation group) ELISA Kit

Sign In for Pricing
View Details
Recombinant Pasteurella Multocida PM0825 Protein (aa 1-179)
VAng-Cr7116-1mgEcoli 1 mg (E. coli)

Recombinant Pasteurella Multocida PM0825 Protein (aa 1-179)

Sign In for Pricing
View Details
Olr315 3'UTR Luciferase Stable Cell Line
TU215107 1.0 mL

Olr315 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Serine Palmitoyltransferase, Long Chain Base Subunit 3 (SPTLC3)
MBS2079283-01 0.1 mL

APC-Linked Polyclonal Antibody to Serine Palmitoyltransferase, Long Chain Base Subunit 3 (SPTLC3)

Sign In for Pricing
View Details