Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alg8 Rabbit Polyclonal Antibody (HRP)

Alg8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC124750, Alg8

UniProt

Q497D1

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LELKLLDPSQIPRASMTSGLVQQSQHTVLPSVSPSATLICTLIAILPSVF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001029299

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTA2 Antibody Cocktail / Alpha Actin
orb2639153 100 µg

ACTA2 Antibody Cocktail / Alpha Actin

Sign In for Pricing
View Details
Rab33a sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3925304 1.0 µg DNA

Rab33a sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
CAMK2N2 Protein Lysate (Mouse) with C-HA Tag
14962034 100 µg

CAMK2N2 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
CYLC1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0548407 1.0 µg DNA

CYLC1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Falcon Hts Fluoroblock 3um Cell Culture Inserts For 24 Well Plate
351151 48 / PCK

Falcon Hts Fluoroblock 3um Cell Culture Inserts For 24 Well Plate

Sign In for Pricing
View Details
Xrcc6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6780808 1.0 µg DNA

Xrcc6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details