Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tecrl Rabbit Polyclonal Antibody (Biotin)

Tecrl Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Srd5, Srd5a2l2, D330017N19Rik

UniProt

Q8BFZ1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Tecrl

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AGPLKTTTAVKHSKTTHFEIEILDAHTRKQICIVDKVTQTSTIHDVKQKF

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_722496

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C6orf52 Human qPCR Primer Pair (NM_001145020)
HP231154 200 Reactions

C6orf52 Human qPCR Primer Pair (NM_001145020)

Sign In for Pricing
View Details
PFKFB1 (N-term) Rabbit Polyclonal Antibody
AP15140PU-N 400 µL

PFKFB1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human CMTM6 activation kit by CRISPRa
GA110368 1 Kit

Human CMTM6 activation kit by CRISPRa

Sign In for Pricing
View Details
Human TMEM185A activation kit by CRISPRa
GA113593 1 Kit

Human TMEM185A activation kit by CRISPRa

Sign In for Pricing
View Details
Human MRPS5 activation kit by CRISPRa
GA112209 1 Kit

Human MRPS5 activation kit by CRISPRa

Sign In for Pricing
View Details
SMURF 2 (SMURF2) Human Gene Knockout Kit (CRISPR)
KN210866 1 Kit

SMURF 2 (SMURF2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details