Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM9SF1 Rabbit Polyclonal Antibody (FITC)

TM9SF1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MP70, HMP70

UniProt

O15321

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TM9SF1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: THTYSVRWSETSVERRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLV

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_006396

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDH8 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
36114124 3x 1.0µg DNA

PCDH8 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
CIC Antibody - N-terminal region : FITC (ARP32498_T100-FITC)
ARP32498_T100-FITC 100 µL

CIC Antibody - N-terminal region : FITC (ARP32498_T100-FITC)

Sign In for Pricing
View Details
RHOV Antibody - N-terminal region
ARP90308_P050-25UL 25 µL

RHOV Antibody - N-terminal region

Sign In for Pricing
View Details
CCK4 (PTK7), NT (PTK7, CCK4, Inactive tyrosine-protein kinase 7, Colon carcinoma kinase 4, Protein-tyrosine kinase 7, Pseudo tyrosine kinase receptor 7, Tyrosine-protein kinase-like 7) (Azide free) (HRP)
MBS6281996-01 0.2 mL

CCK4 (PTK7), NT (PTK7, CCK4, Inactive tyrosine-protein kinase 7, Colon carcinoma kinase 4, Protein-tyrosine kinase 7, Pseudo tyrosine kinase receptor 7, Tyrosine-protein kinase-like 7) (Azide free) (HRP)

Sign In for Pricing
View Details
CCK4 (PTK7), NT (PTK7, CCK4, Inactive tyrosine-protein kinase 7, Colon carcinoma kinase 4, Protein-tyrosine kinase 7, Pseudo tyrosine kinase receptor 7, Tyrosine-protein kinase-like 7) (Azide free) (HRP)
MBS6281996-02 5x 0.2 mL

CCK4 (PTK7), NT (PTK7, CCK4, Inactive tyrosine-protein kinase 7, Colon carcinoma kinase 4, Protein-tyrosine kinase 7, Pseudo tyrosine kinase receptor 7, Tyrosine-protein kinase-like 7) (Azide free) (HRP)

Sign In for Pricing
View Details
BCHE Rabbit Polyclonal Antibody (Biotin)
orb2583558 100 µg

BCHE Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details