Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEPRO Rabbit Polyclonal Antibody (HRP)

NEPRO Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ANXD3, NET17, C3orf17

UniProt

Q6NW34

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C3orf17

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KQLLNSGVSMPVIQTKEKMIHENLRGIHENETDSWTVMQINKNSTSGTIK

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_056227

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-D-Bip (4,4’) -OH
HY-W010838-01 1 g

Fmoc-D-Bip (4,4’) -OH

Sign In for Pricing
View Details
Fmoc-D-Bip (4,4’) -OH
HY-W010838-02 5 g

Fmoc-D-Bip (4,4’) -OH

Sign In for Pricing
View Details
Fmoc-D-Bip (4,4’) -OH
HY-W010838-03 10 g

Fmoc-D-Bip (4,4’) -OH

Sign In for Pricing
View Details
Fmoc-D-Bip (4,4’) -OH
HY-W010838-04 25 g

Fmoc-D-Bip (4,4’) -OH

Sign In for Pricing
View Details
Lentiviral human FAXC shRNA (UAS) - Lentiviral human FAXC shRNA (UAS, GFP) plasmid
GTR15345013 1 Vial

Lentiviral human FAXC shRNA (UAS) - Lentiviral human FAXC shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
IgM (AGM1, IGHM, Constant Region of Heavy Chain of IgM, Ig Mu Chain C Region, Immunoglobulin Mu Heavy Chain) (BSA & Azide Free) (MaxLight 550)
172112-AF-ML550 100 µL

IgM (AGM1, IGHM, Constant Region of Heavy Chain of IgM, Ig Mu Chain C Region, Immunoglobulin Mu Heavy Chain) (BSA & Azide Free) (MaxLight 550)

Sign In for Pricing
View Details