Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALC Rabbit Polyclonal Antibody (HRP)

GALC Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P54803

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GALC

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVAL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000144

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AZI2 Antibody - middle region : FITC (ARP62739_P050-FITC)
ARP62739_P050-FITC 100 µL

AZI2 Antibody - middle region : FITC (ARP62739_P050-FITC)

Sign In for Pricing
View Details
Lentiviral human CACNA1I shRNA (UAS) - Lentiviral human CACNA1I shRNA (UAS, iRFP) (100)
GTR15290739 1 Vial

Lentiviral human CACNA1I shRNA (UAS) - Lentiviral human CACNA1I shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
IFluor® 680 Anti-human CD34 Antibody *4H11*
103400I1-AAT 500 Tests

IFluor® 680 Anti-human CD34 Antibody *4H11*

Sign In for Pricing
View Details
K1 Cells
116207 1 Vial

K1 Cells

Sign In for Pricing
View Details
Mex3b CRISPR/Cas9 KO Plasmid (m)
sc-430856 20 µg

Mex3b CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
CD158e Polyclonal Antibody
orb2656976-01 50 µL

CD158e Polyclonal Antibody

Sign In for Pricing
View Details