Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALC Rabbit Polyclonal Antibody (HRP)

GALC Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P54803

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GALC

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVAL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000144

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCR2 antagonist 3 10mg
A20467-10 10 mg

CCR2 antagonist 3 10mg

Sign In for Pricing
View Details
Human CYB5R3 Knockout A549 cell line
GTR15409247 1 Vial

Human CYB5R3 Knockout A549 cell line

Sign In for Pricing
View Details
OTX2 (NM_001270524) Human Tagged ORF Clone
RC233666 10 µg

OTX2 (NM_001270524) Human Tagged ORF Clone

Sign In for Pricing
View Details
ZADH2 Polyclonal Antibody, Cy3 Conjugated
bs-13562R-Cy3 100 µL

ZADH2 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
ROCK2 (NM_004850) Human Tagged ORF Clone Lentiviral Particle
RC217764L2V 200 µL

ROCK2 (NM_004850) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PD-L2 / PDCD1LG2 / CD273 (PDL2/2676), CF568 conjugate, 0.1mg/mL
BNC682676-100 1x 100 µL

PD-L2 / PDCD1LG2 / CD273 (PDL2/2676), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details