Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hepacam2 Rabbit Polyclonal Antibody (HRP)

Hepacam2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1305697

UniProt

B5DEN8

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Hepacam2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VTVPSHTVHGIRGQALYLPVHYGFHTPASDIQIIWLFERSHTTPKYLLGS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001100050

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDRG2, NT (NDRG2, KIAA1248, SYLD, Protein NDRG2, N-myc downstream-regulated gene 2 protein, Protein Syld709613) (PE) discontinued
038847-PE 200 µL

NDRG2, NT (NDRG2, KIAA1248, SYLD, Protein NDRG2, N-myc downstream-regulated gene 2 protein, Protein Syld709613) (PE) discontinued

Sign In for Pricing
View Details
Porcine Defensins A2 DA2 ELISA Kit
BG-POR10764 1 Each

Porcine Defensins A2 DA2 ELISA Kit

Sign In for Pricing
View Details
IGHM Recombinant Protein (Human)
RP015760 100 µg

IGHM Recombinant Protein (Human)

Sign In for Pricing
View Details
Rat Rtl5 Pre-designed siRNA Set A
SI212299A 1 Each

Rat Rtl5 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-human CD25 IL2RA Monoclonal Antibody APC Conjugated, Flow Validated
FC00214-APC-01 100 Tests

Anti-human CD25 IL2RA Monoclonal Antibody APC Conjugated, Flow Validated

Sign In for Pricing
View Details
Anti-human CD25 IL2RA Monoclonal Antibody APC Conjugated, Flow Validated
FC00214-APC-02 200 Tests

Anti-human CD25 IL2RA Monoclonal Antibody APC Conjugated, Flow Validated

Sign In for Pricing
View Details