Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHIC1 Rabbit Polyclonal Antibody (HRP)

CHIC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BRX

UniProt

Q5JSZ4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CHIC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAPEEFKTSIGRV

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001034929

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Mast Cell Tryptase (MCT) ELISA Kit
CSB-E14326m-01 48 Tests

Mouse Mast Cell Tryptase (MCT) ELISA Kit

Sign In for Pricing
View Details
Mouse Mast Cell Tryptase (MCT) ELISA Kit
CSB-E14326m-02 96 Tests

Mouse Mast Cell Tryptase (MCT) ELISA Kit

Sign In for Pricing
View Details
Mouse Mast Cell Tryptase (MCT) ELISA Kit
CSB-E14326m-03 5x 96 Tests

Mouse Mast Cell Tryptase (MCT) ELISA Kit

Sign In for Pricing
View Details
Mouse Mast Cell Tryptase (MCT) ELISA Kit
CSB-E14326m-04 10x 96 Tests

Mouse Mast Cell Tryptase (MCT) ELISA Kit

Sign In for Pricing
View Details
ROBO4 Conjugated Antibody
orb1619342 100 µL

ROBO4 Conjugated Antibody

Sign In for Pricing
View Details
TAX1BP1 Antibody, Biotin conjugated
CSB-PA771448LD01HU-01 50 µg

TAX1BP1 Antibody, Biotin conjugated

Sign In for Pricing
View Details