Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDH8 Rabbit Polyclonal Antibody (HRP)

CDH8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Nbla04261

UniProt

P55286

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CDH8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HENAALNSVIGQVTARDPDITSSPIRFSIDRHTDLERQFNINADDGKITL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001787

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kappa Light Chain (HCAK1, Ig kappa Chain C Region, IGKC, Immunoglobulin kappa Constant Region, Immunoglobulin kappa Light Chain, Kappa 1 Immunoglobulin Light Chain, Km, MGC111575, MGC62011, MGC72072, MGC88770, MGC88771, MGC88809) (HRP) discontinued
K0090-HRP 100 µL

Kappa Light Chain (HCAK1, Ig kappa Chain C Region, IGKC, Immunoglobulin kappa Constant Region, Immunoglobulin kappa Light Chain, Kappa 1 Immunoglobulin Light Chain, Km, MGC111575, MGC62011, MGC72072, MGC88770, MGC88771, MGC88809) (HRP) discontinued

Sign In for Pricing
View Details
Recombinant Macaca nemestrina Melanocyte-stimulating hormone receptor (MC1R)
MBS7019905-01 0.02 mg

Recombinant Macaca nemestrina Melanocyte-stimulating hormone receptor (MC1R)

Sign In for Pricing
View Details
Recombinant Macaca nemestrina Melanocyte-stimulating hormone receptor (MC1R)
MBS7019905-02 0.1 mg

Recombinant Macaca nemestrina Melanocyte-stimulating hormone receptor (MC1R)

Sign In for Pricing
View Details
Recombinant Macaca nemestrina Melanocyte-stimulating hormone receptor (MC1R)
MBS7019905-03 5x 0.1 mg

Recombinant Macaca nemestrina Melanocyte-stimulating hormone receptor (MC1R)

Sign In for Pricing
View Details
Antithrombin III/SERPINC1 Rabbit Polyclonal Antibody
orb138017 100 µg

Antithrombin III/SERPINC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
6-o-Desmethyl moxonidine
CPA45733-01 1 mg

6-o-Desmethyl moxonidine

Sign In for Pricing
View Details