Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZP2 Rabbit Polyclonal Antibody (HRP)

ZP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZPA, Zp-2, OOMD6

UniProt

Q05996

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PDSFPQWNVVVDGCAYDLDNYQTTFHPVGSSVTHPDHYQRFDMKAFAFVS

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003451

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3056), CF568 conjugate, 0.1mg/mL
BNC683056-500 1x 500 µL

Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3056), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
epithelial Sodium Channel gamma (SCNN1G) Rabbit Polyclonal Antibody
TA381299 100 µL

epithelial Sodium Channel gamma (SCNN1G) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DLX4 (NM_138281) Human Over-expression Lysate
LC403346 20 µg

DLX4 (NM_138281) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB510309 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
p63 (TP63) (NM_001114979) Human Over-expression Lysate
LC426515 20 µg

p63 (TP63) (NM_001114979) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PDE11A activation kit by CRISPRa
GA109479 1 Kit

Human PDE11A activation kit by CRISPRa

Sign In for Pricing
View Details