Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAVCR2 Rabbit Polyclonal Antibody (HRP)

HAVCR2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TIM3, CD366, KIM-3, SPTCL, TIMD3, Tim-3, TIMD-3, HAVcr-2

UniProt

Q8TDQ0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HAVCR2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVP

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_116171

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Arabidopsis thaliana UDP-glycosyltransferase 88A1 (UGT88A1)
orb1096344-01 20 µg

Recombinant Arabidopsis thaliana UDP-glycosyltransferase 88A1 (UGT88A1)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana UDP-glycosyltransferase 88A1 (UGT88A1)
orb1096344-02 100 µg

Recombinant Arabidopsis thaliana UDP-glycosyltransferase 88A1 (UGT88A1)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana UDP-glycosyltransferase 88A1 (UGT88A1)
orb1096344-03 1 mg

Recombinant Arabidopsis thaliana UDP-glycosyltransferase 88A1 (UGT88A1)

Sign In for Pricing
View Details
Anti-IFN- alpha1 IFNA1 Antibody
A09608 100 µL

Anti-IFN- alpha1 IFNA1 Antibody

Sign In for Pricing
View Details
Human PARP4 Knockout HEK293T cell line
GTR15416074 1 Vial

Human PARP4 Knockout HEK293T cell line

Sign In for Pricing
View Details
Cadherin EGF LAG Seven Pass G-Type Receptor 2 (CELSR2) Antibody
abx326797-01 50 µg

Cadherin EGF LAG Seven Pass G-Type Receptor 2 (CELSR2) Antibody

Sign In for Pricing
View Details