Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MUC12 Rabbit Polyclonal Antibody (FITC)

MUC12 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MUC11, MUC-11, MUC-12

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MUC12

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PSVLVGDSTPSPISSGSMETTALPGSTTKPGLSEKSTTFYSSPRSPDTTH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

XP_499351

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B7-2 (CD86) (NM_175862) Human Recombinant Protein
PROTP42081 20 µg

B7-2 (CD86) (NM_175862) Human Recombinant Protein

Sign In for Pricing
View Details
RGD1309313 3'UTR GFP Stable Cell Line
TU267822 1.0 mL

RGD1309313 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-GLT25D1/COLGALT1 Antibody Picoband®, Cy3 Conjugate
A12583-1-Cy3 100 µg/Vial

Anti-GLT25D1/COLGALT1 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
CBR1 Protein Vector (Human) (pPB-N-His)
PV007630 500 ng

CBR1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 Antibody
orb1712256 0.5 mL

MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 Antibody

Sign In for Pricing
View Details
RAB30 3'UTR GFP Stable Cell Line
TU069383 1.0 mL

RAB30 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details