Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM15 Rabbit Polyclonal Antibody (HRP)

PRDM15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PFM15, ZNF298, C21orf83

UniProt

P57071

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PRDM15

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LCGTKVSTRASMSRHMRRKHPEVLAVRIDDLDHLPETTTIDASSIGIVQP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

134kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001035514

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP7D3 CRISPR Activation Plasmid (m2)
sc-435840-ACT-2 20 µg

MAP7D3 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Tssk6, CT (Tssk6, Sstk, Testis-specific serine/threonine-protein kinase 6, Serine/threonine-protein kinase SSTK, Small serine/threonine kinase) (MaxLight 405)
MBS6359776-01 0.1 mL

Tssk6, CT (Tssk6, Sstk, Testis-specific serine/threonine-protein kinase 6, Serine/threonine-protein kinase SSTK, Small serine/threonine kinase) (MaxLight 405)

Sign In for Pricing
View Details
Tssk6, CT (Tssk6, Sstk, Testis-specific serine/threonine-protein kinase 6, Serine/threonine-protein kinase SSTK, Small serine/threonine kinase) (MaxLight 405)
MBS6359776-02 5x 0.1 mL

Tssk6, CT (Tssk6, Sstk, Testis-specific serine/threonine-protein kinase 6, Serine/threonine-protein kinase SSTK, Small serine/threonine kinase) (MaxLight 405)

Sign In for Pricing
View Details
Mouse Monoclonal SIRP beta 1/CD172b Antibody (308908) [FITC]
FAB20961F 0.1 mL

Mouse Monoclonal SIRP beta 1/CD172b Antibody (308908) [FITC]

Sign In for Pricing
View Details
Anti-African malaria mosquito CLIPA14 Antibody-iFluor647 Conjugate
DZ41073-iFluor647 200 µL

Anti-African malaria mosquito CLIPA14 Antibody-iFluor647 Conjugate

Sign In for Pricing
View Details
Cytokeratin 19, Antibody
GWB-311FE5 0.1 mg

Cytokeratin 19, Antibody

Sign In for Pricing
View Details