Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIPI Rabbit Polyclonal Antibody (Biotin)

LIPI Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CT17, LPDL, PLA1C, PRED5, mPA-PLA1 beta

UniProt

Q6XZB0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LIPI

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YFVLSIIVPDKTMMDGSFSFKLLNQLGMIEEPRLYEKNKPFYKLQEVKIL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_945347

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZC3H7A, ID (ZC3H7A, ZC3H7, ZC3HDC7, Zinc finger CCCH domain-containing protein 7A) (PE)
MBS6364841-01 0.2 mL

ZC3H7A, ID (ZC3H7A, ZC3H7, ZC3HDC7, Zinc finger CCCH domain-containing protein 7A) (PE)

Sign In for Pricing
View Details
ZC3H7A, ID (ZC3H7A, ZC3H7, ZC3HDC7, Zinc finger CCCH domain-containing protein 7A) (PE)
MBS6364841-02 5x 0.2 mL

ZC3H7A, ID (ZC3H7A, ZC3H7, ZC3HDC7, Zinc finger CCCH domain-containing protein 7A) (PE)

Sign In for Pricing
View Details
Integrin, beta1 (CD29, Very Late Antigen, VLAb1, Platelet gplla) (HRP)
I7661-39J-HRP 100 µL

Integrin, beta1 (CD29, Very Late Antigen, VLAb1, Platelet gplla) (HRP)

Sign In for Pricing
View Details
Lentiviral mouse Rpl22 shRNA (UAS) - Lentiviral mouse Rpl22 shRNA (UAS, iRFP) (100)
GTR15222135 1 Vial

Lentiviral mouse Rpl22 shRNA (UAS) - Lentiviral mouse Rpl22 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
LEO1 Rabbit Polyclonal Antibody
orb1804675 100 µg

LEO1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RBM4, CT (RBM4, RBM4A, RNA-binding protein 4, Lark homolog, RNA-binding motif protein 4, RNA-binding motif protein 4a)
040895 200 µL

RBM4, CT (RBM4, RBM4A, RNA-binding protein 4, Lark homolog, RNA-binding motif protein 4, RNA-binding motif protein 4a)

Sign In for Pricing
View Details