Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Memo1 Rabbit Polyclonal Antibody (HRP)

Memo1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

0610016J10Rik, D930048L02Rik

UniProt

Q91VH6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_598532

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsp105 (HSPH1) Rabbit Polyclonal Antibody
TA377272 100 µL

Hsp105 (HSPH1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Tmem94 activation kit by CRISPRa
GA209027 1 Kit

Mouse Tmem94 activation kit by CRISPRa

Sign In for Pricing
View Details
IsoPure™ 96, Automated Purification System, 230V
AP1096-E 1 Each

IsoPure™ 96, Automated Purification System, 230V

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1564R), CF568 conjugate, 0.1mg/mL
BNC681564-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1564R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sodium Difluoroacetate-13C2
TRC-S655022-5MG 5 mg

Sodium Difluoroacetate-13C2

Sign In for Pricing
View Details
Phospho-STING (S366) Recombinant Rabbit monoclonal Antibody
HA723137 100 µL

Phospho-STING (S366) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details