Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRIM1 Rabbit Polyclonal Antibody (Biotin)

PRIM1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P49

UniProt

P49642

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PRIM1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKM

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000937

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acsl4 (NM_053623) Rat Tagged ORF Clone
RR205894 10 µg

Acsl4 (NM_053623) Rat Tagged ORF Clone

Sign In for Pricing
View Details
PHOX2B Recombinant Antibody, Cy5 Conjugated
bsm-61755R-Cy5-TR 20 µL

PHOX2B Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Polyclonal Antibody to Fibroblast Growth Factor 21 (FGF21)
MBS2027242-01 0.1 mL

Polyclonal Antibody to Fibroblast Growth Factor 21 (FGF21)

Sign In for Pricing
View Details
Polyclonal Antibody to Fibroblast Growth Factor 21 (FGF21)
MBS2027242-02 0.2 mL

Polyclonal Antibody to Fibroblast Growth Factor 21 (FGF21)

Sign In for Pricing
View Details
Polyclonal Antibody to Fibroblast Growth Factor 21 (FGF21)
MBS2027242-03 0.5 mL

Polyclonal Antibody to Fibroblast Growth Factor 21 (FGF21)

Sign In for Pricing
View Details
Polyclonal Antibody to Fibroblast Growth Factor 21 (FGF21)
MBS2027242-04 1 mL

Polyclonal Antibody to Fibroblast Growth Factor 21 (FGF21)

Sign In for Pricing
View Details