Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARVB Rabbit Polyclonal Antibody (HRP)

PARVB Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CGI-56

UniProt

Q96PN1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PARVB

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVE

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001003828

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC39A13 3'UTR GFP Stable Cell Line
TU073624 1.0 mL

SLC39A13 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Fc Fragment Of IgG Binding Protein (FcgBP)
TRV-0006516-01 10 µg

Recombinant Fc Fragment Of IgG Binding Protein (FcgBP)

Sign In for Pricing
View Details
Recombinant Fc Fragment Of IgG Binding Protein (FcgBP)
TRV-0006516-02 50 µg

Recombinant Fc Fragment Of IgG Binding Protein (FcgBP)

Sign In for Pricing
View Details
Recombinant Fc Fragment Of IgG Binding Protein (FcgBP)
TRV-0006516-03 100 µg

Recombinant Fc Fragment Of IgG Binding Protein (FcgBP)

Sign In for Pricing
View Details
Recombinant Fc Fragment Of IgG Binding Protein (FcgBP)
TRV-0006516-04 200 µg

Recombinant Fc Fragment Of IgG Binding Protein (FcgBP)

Sign In for Pricing
View Details
Recombinant Fc Fragment Of IgG Binding Protein (FcgBP)
TRV-0006516-05 500 µg

Recombinant Fc Fragment Of IgG Binding Protein (FcgBP)

Sign In for Pricing
View Details