Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCLAF Rabbit Polyclonal Antibody (Biotin)

PCLAF Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

L5, PAF, OEATC, PAF15, OEATC1, p15PAF, NS5ATP9, OEATC-1, p15/PAF, KIAA0101, p15 (PAF)

UniProt

A6NNU5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KIAA0101

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKEHVLCNLI

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

7kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001025160

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATR (FRP1, SCKL1, Ataxia telangiectasia and RAD 3 Related Protein) (MaxLight 490) discontinued
A4020-01B-ML490 100 µL

ATR (FRP1, SCKL1, Ataxia telangiectasia and RAD 3 Related Protein) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Serum Amyloid A (SAA) Magnetic Fluorescence Assay Kit
MBS2156574-01 96 Tests

Serum Amyloid A (SAA) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Serum Amyloid A (SAA) Magnetic Fluorescence Assay Kit
MBS2156574-02 5x 96 Tests

Serum Amyloid A (SAA) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Serum Amyloid A (SAA) Magnetic Fluorescence Assay Kit
MBS2156574-03 10x 96 Tests

Serum Amyloid A (SAA) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
KDM7A Polyclonal Antibody
MBS9128824-01 0.02 mL

KDM7A Polyclonal Antibody

Sign In for Pricing
View Details
KDM7A Polyclonal Antibody
MBS9128824-02 0.1 mL

KDM7A Polyclonal Antibody

Sign In for Pricing
View Details