Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BLK Rabbit Polyclonal Antibody (HRP)

BLK Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MODY11

UniProt

P51451

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human BLK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAY

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001706

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium carbonate monohydrate
S04484-01 500 g

Sodium carbonate monohydrate

Sign In for Pricing
View Details
Sodium carbonate monohydrate
S04484-02 1000 g

Sodium carbonate monohydrate

Sign In for Pricing
View Details
Sodium carbonate monohydrate
S04484-03 5000 g

Sodium carbonate monohydrate

Sign In for Pricing
View Details
Ub (Acetyl Lys27) Polyclonal Antibody
UB-GEN-2274 100 µL

Ub (Acetyl Lys27) Polyclonal Antibody

Sign In for Pricing
View Details
CDC27 Rabbit pAb, PerCP-Cy7 conjugated
orb2842471 100 µL

CDC27 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Human CXCL1/GRO alpha Quantikine ELISA Kit 2nd Gen
DGR00B 96 Tests

Human CXCL1/GRO alpha Quantikine ELISA Kit 2nd Gen

Sign In for Pricing
View Details