Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FEN1 Rabbit Polyclonal Antibody (HRP)

FEN1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MF1, RAD2, FEN-1

UniProt

P39748

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: APSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSH

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004102

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PTGER3 Protein, N-His
orb3061728-01 50 µg

Recombinant Human PTGER3 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PTGER3 Protein, N-His
orb3061728-02 100 µg

Recombinant Human PTGER3 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PTGER3 Protein, N-His
orb3061728-03 1 mg

Recombinant Human PTGER3 Protein, N-His

Sign In for Pricing
View Details
Aggrecan (AGC1, CSPG1, MSK16, ACAN) (AP) discontinued
214472-AP 100 µL

Aggrecan (AGC1, CSPG1, MSK16, ACAN) (AP) discontinued

Sign In for Pricing
View Details
C1QL3 (Complement Component 1, q Subcomponent-like 3, C1ql, K100)
244012 50 µg

C1QL3 (Complement Component 1, q Subcomponent-like 3, C1ql, K100)

Sign In for Pricing
View Details
C-erbB2 (HER-2, neu Receptor) (APC) discontinued
C0026-11W-APC 100 µL

C-erbB2 (HER-2, neu Receptor) (APC) discontinued

Sign In for Pricing
View Details