Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FEN1 Rabbit Polyclonal Antibody (HRP)

FEN1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MF1, RAD2, FEN-1

UniProt

P39748

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: APSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSH

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004102

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ARHGAP18 shRNA (UAS) - Lentiviral human ARHGAP18 shRNA (UAS, GFP) (25)
GTR15161732 1 Vial

Lentiviral human ARHGAP18 shRNA (UAS) - Lentiviral human ARHGAP18 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
APOL6 Antibody
CSB-PA035949-01 50 μL

APOL6 Antibody

Sign In for Pricing
View Details
APOL6 Antibody
CSB-PA035949-02 100 µL

APOL6 Antibody

Sign In for Pricing
View Details
Recombinant Monkeypox virus/MPXV M1R Protein, C-His
EVV13301 100 μg

Recombinant Monkeypox virus/MPXV M1R Protein, C-His

Sign In for Pricing
View Details
PDGFRA Antibody (D1033) Blocking peptide
orb1446125 500 µg

PDGFRA Antibody (D1033) Blocking peptide

Sign In for Pricing
View Details
ECHS1 Rabbit Polyclonal Antibody (HRP)
orb2594293 100 µg

ECHS1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details