Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEURL1 Rabbit Polyclonal Antibody (HRP)

NEURL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Neu, NEUR1, NEURL, RNF67, neu-1, bA416N2.1

UniProt

O76050

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NEURL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RLKITKKQCCWSGALRLGFTSKDPSRIHPDSLPKYACPDLVSQSGFWAKA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004201

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/3126R), CF568 conjugate, 0.1mg/mL
BNC683126-500 1x 500 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/3126R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Collagen VII (LH7.2), CF640R conjugate, 0.1mg/mL
BNC402315-100 1x 100 µL

Collagen VII (LH7.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD161/NK1.1 Antibody[PK136]
E-AB-F0987J-01 50 Tests

PerCP/Cyanine5.5 Anti-Mouse CD161/NK1.1 Antibody[PK136]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD161/NK1.1 Antibody[PK136]
E-AB-F0987J-02 100 Tests

PerCP/Cyanine5.5 Anti-Mouse CD161/NK1.1 Antibody[PK136]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD161/NK1.1 Antibody[PK136]
E-AB-F0987J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Mouse CD161/NK1.1 Antibody[PK136]

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-18/IL-18 Protein (His Tag)
PKSM041079-01 20 µg

Recombinant Mouse Interleukin-18/IL-18 Protein (His Tag)

Sign In for Pricing
View Details