Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEURL1 Rabbit Polyclonal Antibody (HRP)

NEURL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Neu, NEUR1, NEURL, RNF67, neu-1, bA416N2.1

UniProt

O76050

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NEURL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RLKITKKQCCWSGALRLGFTSKDPSRIHPDSLPKYACPDLVSQSGFWAKA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004201

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLC25A32 activation kit by CRISPRa
GA113016 1 Kit

Human SLC25A32 activation kit by CRISPRa

Sign In for Pricing
View Details
Live-or-DyeTM 750/777 Fixable Viability Staining Kit (200 assays)
#32008 1 Kit

Live-or-DyeTM 750/777 Fixable Viability Staining Kit (200 assays)

Sign In for Pricing
View Details
JKAMP (NM_001284201) Human Tagged ORF Clone
RG237450 10 µg

JKAMP (NM_001284201) Human Tagged ORF Clone

Sign In for Pricing
View Details
UBD Polyclonal Antibody
E-AB-52823-01 20 µL

UBD Polyclonal Antibody

Sign In for Pricing
View Details
UBD Polyclonal Antibody
E-AB-52823-02 60 µL

UBD Polyclonal Antibody

Sign In for Pricing
View Details
UBD Polyclonal Antibody
E-AB-52823-03 120 µL

UBD Polyclonal Antibody

Sign In for Pricing
View Details