Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fam55d Rabbit Polyclonal Antibody (FITC)

Fam55d Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Fam55, Fam55d, C130036J11, D930028F11Rik

UniProt

Q52KP5

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NSDVERFSDFHGYTQYLALKDIFQDLNVGVIDAWDMTVAYGINNVHPPED

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_766509

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Texas Red Conjugated Rabbit Affinity Purified Antibody to Equine IgG
TAF-531-1 1 mL

Texas Red Conjugated Rabbit Affinity Purified Antibody to Equine IgG

Sign In for Pricing
View Details
ZBTB41 Human Gene Knockout Kit (CRISPR)
KN420171 1 Kit

ZBTB41 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NCR1 Mouse Monoclonal Antibody [Clone ID: B-N40]
AM31279FC-N 1 mL (100 Tests)

NCR1 Mouse Monoclonal Antibody [Clone ID: B-N40]

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS806523 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/3134R), CF594 conjugate, 0.1mg/mL
BNC943134-500 1x 500 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/3134R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GTF2H2C (NM_001098728) Human Over-expression Lysate
LC420670 20 µg

GTF2H2C (NM_001098728) Human Over-expression Lysate

Sign In for Pricing
View Details