Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CENPA Rabbit Polyclonal Antibody (HRP)

CENPA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CenH3, CENP-A

UniProt

P49450

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CENPA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001800

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MX1 Protein Lysate
MBS8415650-01 0.02 mg

Human MX1 Protein Lysate

Sign In for Pricing
View Details
Human MX1 Protein Lysate
MBS8415650-02 5x 0.02 mg

Human MX1 Protein Lysate

Sign In for Pricing
View Details
Recombinant Stenotrophomonas maltophilia UPF0059 membrane protein Smal_3977 (Smal_3977)
orb2912980-01 20 µg

Recombinant Stenotrophomonas maltophilia UPF0059 membrane protein Smal_3977 (Smal_3977)

Sign In for Pricing
View Details
Recombinant Stenotrophomonas maltophilia UPF0059 membrane protein Smal_3977 (Smal_3977)
orb2912980-02 100 µg

Recombinant Stenotrophomonas maltophilia UPF0059 membrane protein Smal_3977 (Smal_3977)

Sign In for Pricing
View Details
Recombinant Human TGFBR1/ALK-5 Protein (His & Fc Tag)
PKSH031596 100 µg

Recombinant Human TGFBR1/ALK-5 Protein (His & Fc Tag)

Sign In for Pricing
View Details
AIFM2 (Apoptosis-inducing Factor 2, Apoptosis-inducing Factor Homologous Mitochondrion-associated Inducer of Death, Apoptosis-inducing Factor-like Mitochondrion-associated Inducer of Death, p53-responsive Gene 3 Protein, AMID, PRG3, DKFZp686L1298, FLJ14497, RP11-367H5.2)
123109 100 µg

AIFM2 (Apoptosis-inducing Factor 2, Apoptosis-inducing Factor Homologous Mitochondrion-associated Inducer of Death, Apoptosis-inducing Factor-like Mitochondrion-associated Inducer of Death, p53-responsive Gene 3 Protein, AMID, PRG3, DKFZp686L1298, FLJ14497, RP11-367H5.2)

Sign In for Pricing
View Details