Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAD Rabbit Polyclonal Antibody (HRP)

CAD Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CDG1Z, DEE50, GATD4, EIEE50

UniProt

P27708

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CAD

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREEL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

243kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004332

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACP1 (Low Molecular Weight Phosphotyrosine Protein Phosphatase, LMW-PTP, LMW-PTPase, Low Molecular Weight Cytosolic Acid Phosphatase, Red Cell Acid Phosphatase 1, PTPase, Adipocyte Acid Phosphatase) (HRP)
122893-HRP 100 µL

ACP1 (Low Molecular Weight Phosphotyrosine Protein Phosphatase, LMW-PTP, LMW-PTPase, Low Molecular Weight Cytosolic Acid Phosphatase, Red Cell Acid Phosphatase 1, PTPase, Adipocyte Acid Phosphatase) (HRP)

Sign In for Pricing
View Details
Mouse Phosphatidylinositol glycan anchor biosynthesis class U protein, PIGU ELISA Kit
MBS9319898-01 48 Well

Mouse Phosphatidylinositol glycan anchor biosynthesis class U protein, PIGU ELISA Kit

Sign In for Pricing
View Details
Mouse Phosphatidylinositol glycan anchor biosynthesis class U protein, PIGU ELISA Kit
MBS9319898-02 96 Well

Mouse Phosphatidylinositol glycan anchor biosynthesis class U protein, PIGU ELISA Kit

Sign In for Pricing
View Details
Mouse Phosphatidylinositol glycan anchor biosynthesis class U protein, PIGU ELISA Kit
MBS9319898-03 5x 96 Well

Mouse Phosphatidylinositol glycan anchor biosynthesis class U protein, PIGU ELISA Kit

Sign In for Pricing
View Details
Mouse Phosphatidylinositol glycan anchor biosynthesis class U protein, PIGU ELISA Kit
MBS9319898-04 10x 96 Well

Mouse Phosphatidylinositol glycan anchor biosynthesis class U protein, PIGU ELISA Kit

Sign In for Pricing
View Details
PTBP1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
38054156 3x 1.0 µg DNA

PTBP1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details