Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSDME Rabbit Polyclonal Antibody (HRP)

GSDME Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DFNA5, ICERE-1

UniProt

A4FVA8

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DFNA5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AALLGTCCKLQIIPTLCHLLRALSDDGVSDLEDPTLTPLKDTERFGIVQR

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Rat

Tested Applications

IHC, WB

NCBI Accession Number

AAI25067

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAB1 (GRB2-associated Binder Protein 1, Growth Factor Receptor Bound Protein 2-associated Protein 1, GRB2-associated Binder 1) APC
MBS6379132-01 0.1 mL

GAB1 (GRB2-associated Binder Protein 1, Growth Factor Receptor Bound Protein 2-associated Protein 1, GRB2-associated Binder 1) APC

Sign In for Pricing
View Details
GAB1 (GRB2-associated Binder Protein 1, Growth Factor Receptor Bound Protein 2-associated Protein 1, GRB2-associated Binder 1) APC
MBS6379132-02 5x 0.1 mL

GAB1 (GRB2-associated Binder Protein 1, Growth Factor Receptor Bound Protein 2-associated Protein 1, GRB2-associated Binder 1) APC

Sign In for Pricing
View Details
Recombinant Human Triosephosphate Isomerase/TIM (N-6His)
32-7238-50 50 µg

Recombinant Human Triosephosphate Isomerase/TIM (N-6His)

Sign In for Pricing
View Details
Monkey Fumarylacetoacetate Hydrolase Domain-Containing Protein 1 (FAHD1) ELISA Kit
MBS9926203-01 48 Well

Monkey Fumarylacetoacetate Hydrolase Domain-Containing Protein 1 (FAHD1) ELISA Kit

Sign In for Pricing
View Details
Monkey Fumarylacetoacetate Hydrolase Domain-Containing Protein 1 (FAHD1) ELISA Kit
MBS9926203-02 96 Well

Monkey Fumarylacetoacetate Hydrolase Domain-Containing Protein 1 (FAHD1) ELISA Kit

Sign In for Pricing
View Details
Monkey Fumarylacetoacetate Hydrolase Domain-Containing Protein 1 (FAHD1) ELISA Kit
MBS9926203-03 5x 96 Well

Monkey Fumarylacetoacetate Hydrolase Domain-Containing Protein 1 (FAHD1) ELISA Kit

Sign In for Pricing
View Details