Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDK3 Rabbit Polyclonal Antibody (Biotin)

PDK3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CMTX6, GS1-358P8.4

UniProt

Q15120

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PDK3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RPSVGLVQSWYMQSFLELLEYENKSPEDPQVLDNFLQVLIKVRNRHNDVV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_005382

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP1A1 Monoclonal Antibody
BT-MCA3126-01 50 µL

ATP1A1 Monoclonal Antibody

Sign In for Pricing
View Details
ATP1A1 Monoclonal Antibody
BT-MCA3126-02 100 µL

ATP1A1 Monoclonal Antibody

Sign In for Pricing
View Details
FRMD6-set siRNA/shRNA/RNAi Lentivector (Human)
20955091 4x 500 ng

FRMD6-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
GGT4P sgRNA CRISPR Lentivector set (Human)
K0854801 3x 1.0 µg

GGT4P sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
ZNF98, CT (ZNF98, ZNF739, Zinc finger protein 98, Zinc finger protein 739, Zinc finger protein F7175) (MaxLight 490)
MBS6368027-01 0.1 mL

ZNF98, CT (ZNF98, ZNF739, Zinc finger protein 98, Zinc finger protein 739, Zinc finger protein F7175) (MaxLight 490)

Sign In for Pricing
View Details
ZNF98, CT (ZNF98, ZNF739, Zinc finger protein 98, Zinc finger protein 739, Zinc finger protein F7175) (MaxLight 490)
MBS6368027-02 5x 0.1 mL

ZNF98, CT (ZNF98, ZNF739, Zinc finger protein 98, Zinc finger protein 739, Zinc finger protein F7175) (MaxLight 490)

Sign In for Pricing
View Details