Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bcat1 Rabbit Polyclonal Antibody (Biotin)

Bcat1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BCAT, Eca3, BCATc, Bcat-, Eca39

UniProt

Q8CBC8

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ACVVCPVSDILYKGETIHIPTMENGPKLASRILSKLTDIQYGREESDWTI

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001019639

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL31 (Interleukin 31, IL-31)
247583 100 µg

IL31 (Interleukin 31, IL-31)

Sign In for Pricing
View Details
Lentiviral human ZNF708 sgRNA gene knockout kit - Lentiviral human ZNF708 sgRNA gene knockout kit (plasmid)
GTR15373034 1 Vial

Lentiviral human ZNF708 sgRNA gene knockout kit - Lentiviral human ZNF708 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Magnetic Field Chamber
1070380/1 1 Each

Magnetic Field Chamber

Sign In for Pricing
View Details
TPRBK/TTC28 Rabbit Polyclonal Antibody (Fluoro550)
orb3095637 100 µg

TPRBK/TTC28 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Anti Pyrraline Monoclonal Antibody (Clone No. H12) Peroxidase conjugated
KH010-02 each

Anti Pyrraline Monoclonal Antibody (Clone No. H12) Peroxidase conjugated

Sign In for Pricing
View Details
CD16 (Fc gamma RIII, NK cells) (Biotin) discontinued
C2267-31A-Biotin 100 µL

CD16 (Fc gamma RIII, NK cells) (Biotin) discontinued

Sign In for Pricing
View Details