Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bcat1 Rabbit Polyclonal Antibody (FITC)

Bcat1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BCAT, Eca3, BCATc, Bcat-, Eca39

UniProt

Q8CBC8

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ACVVCPVSDILYKGETIHIPTMENGPKLASRILSKLTDIQYGREESDWTI

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001019639

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epididymal sperm-binding protein 1 (ELSPBP1) Porcine ELISA Kit
D2146 96 Tests

Epididymal sperm-binding protein 1 (ELSPBP1) Porcine ELISA Kit

Sign In for Pricing
View Details
CALCOCO2 (Calcium Binding and Coiled-coil Domain 2, MGC17318, NDP52) (PE)
MBS6187340-01 0.1 mL

CALCOCO2 (Calcium Binding and Coiled-coil Domain 2, MGC17318, NDP52) (PE)

Sign In for Pricing
View Details
CALCOCO2 (Calcium Binding and Coiled-coil Domain 2, MGC17318, NDP52) (PE)
MBS6187340-02 5x 0.1 mL

CALCOCO2 (Calcium Binding and Coiled-coil Domain 2, MGC17318, NDP52) (PE)

Sign In for Pricing
View Details
B7-H6 Polyclonal Antibody, PE Conjugated
bs-12559R-PE-01 20 µL

B7-H6 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
B7-H6 Polyclonal Antibody, PE Conjugated
bs-12559R-PE-02 100 µL

B7-H6 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Mouse Atp6v0c (NM_009729) AAV Particle
MR201148A1V 250 µL

Mouse Atp6v0c (NM_009729) AAV Particle

Sign In for Pricing
View Details