Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIF Rabbit Polyclonal Antibody (HRP)

PPIF Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CYP3, CypD, CyP-M, Cyp-D

UniProt

P30405

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPIF

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLS

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005720

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACVR2B Rabbit Polyclonal Antibody
orb579375 100 µL

ACVR2B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human phosphatidylinositol glycan anchor biosynthesis, class K polyclonal Antibody
MBS719281-01 0.1 mL

Rabbit anti-human phosphatidylinositol glycan anchor biosynthesis, class K polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human phosphatidylinositol glycan anchor biosynthesis, class K polyclonal Antibody
MBS719281-02 5x 0.1 mL

Rabbit anti-human phosphatidylinositol glycan anchor biosynthesis, class K polyclonal Antibody

Sign In for Pricing
View Details
NHS (Nance-Horan Syndrome (Congenital cataracts and dental anomalies), DKFZp781F2016, DKFZp781L0254, SCML1) (PE)
249317-PE 100 µL

NHS (Nance-Horan Syndrome (Congenital cataracts and dental anomalies), DKFZp781F2016, DKFZp781L0254, SCML1) (PE)

Sign In for Pricing
View Details
Rabbit Neuregulin 1 ELISA Kit
MBS724914-01 48 Well

Rabbit Neuregulin 1 ELISA Kit

Sign In for Pricing
View Details
Rabbit Neuregulin 1 ELISA Kit
MBS724914-02 96 Well

Rabbit Neuregulin 1 ELISA Kit

Sign In for Pricing
View Details