Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSME3 Rabbit Polyclonal Antibody (FITC)

PSME3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ki, PA28G, HEL-S-283, PA28gamma, REG-GAMMA, PA28-gamma

UniProt

P61289

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PSME3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_789839

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSX6, ID (SSX6, Putative protein SSX6) (Biotin)
MBS6351468-01 0.2 mL

SSX6, ID (SSX6, Putative protein SSX6) (Biotin)

Sign In for Pricing
View Details
SSX6, ID (SSX6, Putative protein SSX6) (Biotin)
MBS6351468-02 5x 0.2 mL

SSX6, ID (SSX6, Putative protein SSX6) (Biotin)

Sign In for Pricing
View Details
ABCB9 (ATP-binding Cassette Sub-family B Member 9, ATP-binding Cassette Transporter 9, ABC Transporter 9 Protein, hABCB9, TAP-like Protein, TAPL, KIAA1520) (AP) discontinued
122797-AP 100 µL

ABCB9 (ATP-binding Cassette Sub-family B Member 9, ATP-binding Cassette Transporter 9, ABC Transporter 9 Protein, hABCB9, TAP-like Protein, TAPL, KIAA1520) (AP) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Epn3 shRNA (UAS) - Lentiviral mouse Epn3 shRNA (UAS, iRFP) (100)
GTR15285267 1 Vial

Lentiviral mouse Epn3 shRNA (UAS) - Lentiviral mouse Epn3 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
CD47/MER6 Protein (C-Fc, Human)
P502130 100 µg

CD47/MER6 Protein (C-Fc, Human)

Sign In for Pricing
View Details
IL-1 alpha, Human (HEK293)
HY-P73145-01 5 µg

IL-1 alpha, Human (HEK293)

Sign In for Pricing
View Details