Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DTNB Rabbit Polyclonal Antibody (HRP)

DTNB Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC17163, MGC57126

UniProt

O60941

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DTNB

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEEL

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_149160

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM108C1 (ABHD17C) (NM_021214) Human Over-expression Lysate
E45H11459-2 20 µg

FAM108C1 (ABHD17C) (NM_021214) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Anti-proteinase 3 antibody IgG, PR3 Ab-IgG ELISA Kit
YLA2247HU-01 48 Tests

Human Anti-proteinase 3 antibody IgG, PR3 Ab-IgG ELISA Kit

Sign In for Pricing
View Details
Human Anti-proteinase 3 antibody IgG, PR3 Ab-IgG ELISA Kit
YLA2247HU-02 96 Tests

Human Anti-proteinase 3 antibody IgG, PR3 Ab-IgG ELISA Kit

Sign In for Pricing
View Details
AKR1B10, ID (AKR1B10, AKR1B11, Aldo-keto reductase family 1 member B10, ARL-1, Aldose reductase-like, Aldose reductase-related protein, Small intestine reductase) (APC) discontinued
031740-APC 200 µL

AKR1B10, ID (AKR1B10, AKR1B11, Aldo-keto reductase family 1 member B10, ARL-1, Aldose reductase-like, Aldose reductase-related protein, Small intestine reductase) (APC) discontinued

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Toll Like Receptor Adaptor Molecule 1 (TICAM1)
MBS2079110-01 0.1 mL

HRP-Linked Polyclonal Antibody to Toll Like Receptor Adaptor Molecule 1 (TICAM1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Toll Like Receptor Adaptor Molecule 1 (TICAM1)
MBS2079110-02 0.2 mL

HRP-Linked Polyclonal Antibody to Toll Like Receptor Adaptor Molecule 1 (TICAM1)

Sign In for Pricing
View Details