Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCCC2 Rabbit Polyclonal Antibody (FITC)

MCCC2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MCCB, MCCCbeta

UniProt

Q9HCC0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human MCCC2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RKVVRNLNYQKKLDVTIEPSEEPLFPADELYGIVGANLKRSFDVREVIAR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_071415.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cytochrome P450 family 2 subfamily E polypeptide 1 CLIA Kit
MBS8426174-01 1 Kit

Mouse Cytochrome P450 family 2 subfamily E polypeptide 1 CLIA Kit

Sign In for Pricing
View Details
Mouse Cytochrome P450 family 2 subfamily E polypeptide 1 CLIA Kit
MBS8426174-02 5x 1 Kit

Mouse Cytochrome P450 family 2 subfamily E polypeptide 1 CLIA Kit

Sign In for Pricing
View Details
Human CKLF-like MARVEL transmembrane domain-containing protein 8, CMTM8 ELISA Kit
MBS9335453-01 48 Well

Human CKLF-like MARVEL transmembrane domain-containing protein 8, CMTM8 ELISA Kit

Sign In for Pricing
View Details
Human CKLF-like MARVEL transmembrane domain-containing protein 8, CMTM8 ELISA Kit
MBS9335453-02 96 Well

Human CKLF-like MARVEL transmembrane domain-containing protein 8, CMTM8 ELISA Kit

Sign In for Pricing
View Details
Human CKLF-like MARVEL transmembrane domain-containing protein 8, CMTM8 ELISA Kit
MBS9335453-03 5x 96 Well

Human CKLF-like MARVEL transmembrane domain-containing protein 8, CMTM8 ELISA Kit

Sign In for Pricing
View Details
Human CKLF-like MARVEL transmembrane domain-containing protein 8, CMTM8 ELISA Kit
MBS9335453-04 10x 96 Well

Human CKLF-like MARVEL transmembrane domain-containing protein 8, CMTM8 ELISA Kit

Sign In for Pricing
View Details