Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCCC2 Rabbit Polyclonal Antibody (HRP)

MCCC2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MCCB, MCCCbeta

UniProt

Q9HCC0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human MCCC2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RKVVRNLNYQKKLDVTIEPSEEPLFPADELYGIVGANLKRSFDVREVIAR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_071415.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Irg1 sgRNA CRISPR Lentivector set (Mouse)
K3063001 3x 1.0 µg

Irg1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
RFC3 (Replication Factor C Subunit 3, Activator 1 Subunit 3, Replication Factor C 38kD Subunit, RF-C 38kD Subunit, RFC38, Activator 1 38kD Subunit, A1 38kD Subunit, MGC5276) (MaxLight 650)
MBS6224280-01 0.1 mL

RFC3 (Replication Factor C Subunit 3, Activator 1 Subunit 3, Replication Factor C 38kD Subunit, RF-C 38kD Subunit, RFC38, Activator 1 38kD Subunit, A1 38kD Subunit, MGC5276) (MaxLight 650)

Sign In for Pricing
View Details
RFC3 (Replication Factor C Subunit 3, Activator 1 Subunit 3, Replication Factor C 38kD Subunit, RF-C 38kD Subunit, RFC38, Activator 1 38kD Subunit, A1 38kD Subunit, MGC5276) (MaxLight 650)
MBS6224280-02 5x 0.1 mL

RFC3 (Replication Factor C Subunit 3, Activator 1 Subunit 3, Replication Factor C 38kD Subunit, RF-C 38kD Subunit, RFC38, Activator 1 38kD Subunit, A1 38kD Subunit, MGC5276) (MaxLight 650)

Sign In for Pricing
View Details
FBXO2 (F-box Only Protein 2, FBX2, Fbg1, FBG1, Nfb42, NFB42, OCP1) (PE)
MBS6157770-01 0.1 mL

FBXO2 (F-box Only Protein 2, FBX2, Fbg1, FBG1, Nfb42, NFB42, OCP1) (PE)

Sign In for Pricing
View Details
FBXO2 (F-box Only Protein 2, FBX2, Fbg1, FBG1, Nfb42, NFB42, OCP1) (PE)
MBS6157770-02 5x 0.1 mL

FBXO2 (F-box Only Protein 2, FBX2, Fbg1, FBG1, Nfb42, NFB42, OCP1) (PE)

Sign In for Pricing
View Details
AFD1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0054705 3x 1.0 µg

AFD1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details