Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOC3L Rabbit Polyclonal Antibody (Biotin)

NOC3L Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AD24, FAD24, C10orf117

UniProt

Q8WTT2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NOC3L

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TLKKYRKEQRKLRQAVKDAVSKKPIPLENPKEKRPGKRIEREEEEEEEAL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

92kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_071896

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM56 Human Over-expression Lysate
orb1351275 100 µg

TRIM56 Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Protochlamydia amoebophila Glutamyl-tRNA (Gln) amidotransferase subunit A (gatA)
MBS1401124-01 0.02 mg (E-Coli)

Recombinant Protochlamydia amoebophila Glutamyl-tRNA (Gln) amidotransferase subunit A (gatA)

Sign In for Pricing
View Details
Recombinant Protochlamydia amoebophila Glutamyl-tRNA (Gln) amidotransferase subunit A (gatA)
MBS1401124-02 0.02 mg (Yeast)

Recombinant Protochlamydia amoebophila Glutamyl-tRNA (Gln) amidotransferase subunit A (gatA)

Sign In for Pricing
View Details
Recombinant Protochlamydia amoebophila Glutamyl-tRNA (Gln) amidotransferase subunit A (gatA)
MBS1401124-03 0.1 mg (E-Coli)

Recombinant Protochlamydia amoebophila Glutamyl-tRNA (Gln) amidotransferase subunit A (gatA)

Sign In for Pricing
View Details
Recombinant Protochlamydia amoebophila Glutamyl-tRNA (Gln) amidotransferase subunit A (gatA)
MBS1401124-04 0.1 mg (Yeast)

Recombinant Protochlamydia amoebophila Glutamyl-tRNA (Gln) amidotransferase subunit A (gatA)

Sign In for Pricing
View Details
Recombinant Protochlamydia amoebophila Glutamyl-tRNA (Gln) amidotransferase subunit A (gatA)
MBS1401124-05 0.02 mg (Baculovirus)

Recombinant Protochlamydia amoebophila Glutamyl-tRNA (Gln) amidotransferase subunit A (gatA)

Sign In for Pricing
View Details