Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NT5DC2 Rabbit Polyclonal Antibody (HRP)

NT5DC2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ12442

UniProt

Q9H857

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NT5DC2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IRKYDYNPSFAIRGLHYDIQKSLLMKIDAFHYVQLGTAYRGLQPVPDEEV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_075059

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camel Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 2 (HCN2) ELISA Kit
MBS9393498-01 48 Well

Camel Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 2 (HCN2) ELISA Kit

Sign In for Pricing
View Details
Camel Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 2 (HCN2) ELISA Kit
MBS9393498-02 96 Well

Camel Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 2 (HCN2) ELISA Kit

Sign In for Pricing
View Details
Camel Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 2 (HCN2) ELISA Kit
MBS9393498-03 5x 96 Well

Camel Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 2 (HCN2) ELISA Kit

Sign In for Pricing
View Details
Camel Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 2 (HCN2) ELISA Kit
MBS9393498-04 10x 96 Well

Camel Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 2 (HCN2) ELISA Kit

Sign In for Pricing
View Details
Hand2 Rabbit Polyclonal Antibody
orb329577 100 µL

Hand2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bovine CSN1S2 protein
orb705139-01 20 µg

Bovine CSN1S2 protein

Sign In for Pricing
View Details