Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRPEL1 Rabbit Polyclonal Antibody (HRP)

GRPEL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GrpE, HMGE, mt-GrpE#1

UniProt

Q9HAV7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GRPEL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALAD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human

Tested Applications

WB

NCBI Accession Number

NP_079472

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Fibroblast Growth Factor 8,FGF-8 ELISA KIT
JOT-EK1447Ra-01 96 Well

Rat Fibroblast Growth Factor 8,FGF-8 ELISA KIT

Sign In for Pricing
View Details
Rat Fibroblast Growth Factor 8,FGF-8 ELISA KIT
JOT-EK1447Ra-02 48 Well

Rat Fibroblast Growth Factor 8,FGF-8 ELISA KIT

Sign In for Pricing
View Details
OR52D1 (NM_001005163) Human Tagged ORF Clone
RC214322 10 µg

OR52D1 (NM_001005163) Human Tagged ORF Clone

Sign In for Pricing
View Details
Anti-Fruit fly l (2) efl/CryAB Antibody Fluoro594 Conjugated
DZ41507-Fluoro594 200 µL/Vial

Anti-Fruit fly l (2) efl/CryAB Antibody Fluoro594 Conjugated

Sign In for Pricing
View Details
Human IGFBP4 shRNA Plasmid
abx952358-01 150 µg

Human IGFBP4 shRNA Plasmid

Sign In for Pricing
View Details
Human IGFBP4 shRNA Plasmid
abx952358-02 300 µg

Human IGFBP4 shRNA Plasmid

Sign In for Pricing
View Details