Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adam23 Rabbit Polyclonal Antibody (HRP)

Adam23 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MDC3, AW046396

UniProt

Q9R1V7

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NPNPPKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_035910

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSX5, NT (SSX5, Protein SSX5) (MaxLight 550) discontinued
042342-ML550 100 µL

SSX5, NT (SSX5, Protein SSX5) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Human Haptoglobin (Hpt; HP) ELISA Kit
YP-W10816-01 48 Tests

Human Haptoglobin (Hpt; HP) ELISA Kit

Sign In for Pricing
View Details
Human Haptoglobin (Hpt; HP) ELISA Kit
YP-W10816-02 96 Tests

Human Haptoglobin (Hpt; HP) ELISA Kit

Sign In for Pricing
View Details
SCGB1A1 Antibody
orb1280922 100 µL

SCGB1A1 Antibody

Sign In for Pricing
View Details
HAGHL Rabbit Polyclonal Antibody
orb513508 100 µg

HAGHL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Porcine Foot and Mouth Disease Virus, FMDV Antibody, IgG ELISA Kit
MBS1610196-01 96 Strip Well

Porcine Foot and Mouth Disease Virus, FMDV Antibody, IgG ELISA Kit

Sign In for Pricing
View Details