Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDS2 Rabbit Polyclonal Antibody (FITC)

CDS2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

O95674

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human CDS2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIA

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003809.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase-3/CASP3 Rabbit Polyclonal Antibody (Fluoro647)
orb3083556 100 µg

Caspase-3/CASP3 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Lipoamide Dehydrogenase Rabbit pAb
APA1647-01 30 µL

Lipoamide Dehydrogenase Rabbit pAb

Sign In for Pricing
View Details
Lipoamide Dehydrogenase Rabbit pAb
APA1647-02 50 μL

Lipoamide Dehydrogenase Rabbit pAb

Sign In for Pricing
View Details
Lipoamide Dehydrogenase Rabbit pAb
APA1647-03 100 µL

Lipoamide Dehydrogenase Rabbit pAb

Sign In for Pricing
View Details
TCN2 (Transcobalamin II, II, TC, TC2, TC-2, TCII, TC II, D22S676, D22S750) (AP)
MBS6440169-01 0.1 mL

TCN2 (Transcobalamin II, II, TC, TC2, TC-2, TCII, TC II, D22S676, D22S750) (AP)

Sign In for Pricing
View Details
TCN2 (Transcobalamin II, II, TC, TC2, TC-2, TCII, TC II, D22S676, D22S750) (AP)
MBS6440169-02 5x 0.1 mL

TCN2 (Transcobalamin II, II, TC, TC2, TC-2, TCII, TC II, D22S676, D22S750) (AP)

Sign In for Pricing
View Details