Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDS2 Rabbit Polyclonal Antibody (HRP)

CDS2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

O95674

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human CDS2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIA

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003809.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-chloro-3-iodo-2H-indazole
JH313179 1 Each

6-chloro-3-iodo-2H-indazole

Sign In for Pricing
View Details
T-Complex Protein 1 alpha (T Complex Protein 1 alpha Subunit, T Complex Protein 1 Subunit alpha, TCP1 alpha, TCP1-alpha, TCP-1 alpha, CCT 1, CCT1, CCT alpha, CCTa, D6S230E, T Complex 1, T-complex 1, T Complex Locus TCP1, T-complex Locus TCP-1, T Complex Protein 1, Tailless Complex Polypeptide 1, Tailless Complex Polypeptide 1A, TCP-1, TCP1) (MaxLight 490) discontinued
T2035-02D-ML490 100 µL

T-Complex Protein 1 alpha (T Complex Protein 1 alpha Subunit, T Complex Protein 1 Subunit alpha, TCP1 alpha, TCP1-alpha, TCP-1 alpha, CCT 1, CCT1, CCT alpha, CCTa, D6S230E, T Complex 1, T-complex 1, T Complex Locus TCP1, T-complex Locus TCP-1, T Complex Protein 1, Tailless Complex Polypeptide 1, Tailless Complex Polypeptide 1A, TCP-1, TCP1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
LRMP Rabbit Monoclonal Antibody
AMRe87574-01 1 Each

LRMP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
LRMP Rabbit Monoclonal Antibody
AMRe87574-02 50 µL

LRMP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
LRMP Rabbit Monoclonal Antibody
AMRe87574-03 100 µL

LRMP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
3- (β-D-Glucopyranosyloxy) -1,6-dihydroxy-2-methyl-9,10-anthracenedione
AFA90649-01 25 mg

3- (β-D-Glucopyranosyloxy) -1,6-dihydroxy-2-methyl-9,10-anthracenedione

Sign In for Pricing
View Details