Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK1 Rabbit Polyclonal Antibody (Biotin)

DLK1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DLK, FA1, ZOG, pG2, DLK-1, PREF1, Delta1, Pref-1

UniProt

P80370

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DLK1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_003827

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATOH7, ID (ATOH7, ATH5, BHLHA13, Protein atonal homolog 7, Class A basic helix-loop-helix protein 13, Helix-loop-helix protein hATH-5)
032259 200 µL

ATOH7, ID (ATOH7, ATH5, BHLHA13, Protein atonal homolog 7, Class A basic helix-loop-helix protein 13, Helix-loop-helix protein hATH-5)

Sign In for Pricing
View Details
KCNRG Protein Vector (Human) (pPM-C-His)
PV022232 500 ng

KCNRG Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
GJA7 Antibody Blocking peptide
orb1455322 500 µg

GJA7 Antibody Blocking peptide

Sign In for Pricing
View Details
Human Ribonuclease A7 ELISA Kit
MBS104034-01 48 Well

Human Ribonuclease A7 ELISA Kit

Sign In for Pricing
View Details
Human Ribonuclease A7 ELISA Kit
MBS104034-02 96 Well

Human Ribonuclease A7 ELISA Kit

Sign In for Pricing
View Details
Human Ribonuclease A7 ELISA Kit
MBS104034-03 5x 96 Well

Human Ribonuclease A7 ELISA Kit

Sign In for Pricing
View Details